HOMEPRODUCTSCOMPANYCONTACTFAQResearchDictionaryPharmaSign Up FREE or Login

dual altered peptide ligand

artificial peptide with two immunodominant T-cell epitopes of the nicotinic acetylcholine receptor substituted with Lys-262 and Ala-207 (VIVKLIPSTSSAVDTPYLDITYHFVAQRLPL)
Also Known As:
dual APL
Networked: 9 relevant articles (0 outcomes, 0 trials/studies)

Bio-Agent Context: Research Results

Experts

1. Mozes, Edna: 7 articles (10/2007 - 06/2004)
2. Sela, Michael: 7 articles (10/2007 - 06/2004)
3. Ben-David, Hava: 4 articles (10/2007 - 02/2005)
4. Aruna, Badiga Venkata: 4 articles (11/2006 - 07/2005)
5. Dayan, Molly: 2 articles (10/2007 - 06/2004)
6. Mozes, E: 2 articles (06/2007 - 10/2001)
7. Sela, M: 2 articles (06/2007 - 10/2001)
8. Sharabi, Amir: 1 article (10/2007)
9. Ben-David, H: 1 article (06/2007)
10. Venkata Aruna, B: 1 article (06/2007)

Related Diseases

1. Myasthenia Gravis
2. Experimental Autoimmune Myasthenia Gravis (Autoimmune Experimental Myasthenia Gravis)

Related Drugs and Biologics

1. Peptides (Polypeptides)
2. Phosphotransferases (Kinase)
3. Amino Acids
4. CTLA-4 Antigen
5. Fas Ligand Protein (Fas Ligand)
6. Caspase 8 (Caspase-8)
7. Transforming Growth Factor beta (TGF-beta)
8. Cholinergic Receptors
9. Proteins (Proteins, Gene)

Related Therapies and Procedures

1. Immunomodulation