lixisenatide

A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).

Also Known As:

AQVE-10010; AVE 0010; AVE 010; AVE-0010; AVE-010; AVE0010; Adlyxin; DES-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-l-lysyl-l-lysinamide; Lyxumia; ZP 10; ZP-10; ZP10A peptide

Networked: 308 relevant articles (58 outcomes, 129 trials/studies)

Relationship Network

Bio-Agent Context: Research Results

Amino Acids, Peptides, and Proteins: 1
- Proteins: 484843
  - Membrane Proteins: 10078
    - Cell Surface Receptors: 2125
      - G-Protein-Coupled Receptors: 4701
        Glucagon-Like Peptide Receptors: 50
        Glucagon-Like Peptide-2 Receptor: 25
        lixisenatide: 308
      - Peptide Receptors: 1159
        Gastrointestinal Hormone Receptors: 2
        Glucagon-Like Peptide Receptors: 50
        Glucagon-Like Peptide-2 Receptor: 25
        lixisenatide: 308
- Peptides: 82426
  - lixisenatide: 308

Experts

1.	Niemoeller, Elisabeth: 24 articles (01/2022 - 09/2013)
2.	Souhami, Elisabeth: 20 articles (01/2022 - 09/2013)
3.	Rosenstock, Julio: 19 articles (01/2022 - 09/2013)
4.	Aronson, Ronnie: 11 articles (07/2022 - 09/2013)
5.	Aroda, Vanita R: 11 articles (01/2021 - 09/2016)
6.	Horowitz, Michael: 9 articles (06/2022 - 02/2013)
7.	Stager, William: 9 articles (01/2020 - 09/2016)
8.	Blonde, Lawrence: 8 articles (01/2022 - 01/2017)
9.	Dex, Terry: 8 articles (01/2022 - 01/2017)
10.	Meier, Juris J: 8 articles (01/2022 - 07/2015)

Related Diseases

1.	Type 2 Diabetes Mellitus (MODY) 11/01/2014 - "In Asian patients with type 2 diabetes mellitus insufficiently controlled on metformin ± sulfonylurea, lixisenatide significantly improved glycaemic control and was well tolerated during the 24-week study." 10/01/2017 - "Conclusions: Clinical studies have demonstrated that lixisenatide is a safe and effective treatment option for type 2 diabetes mellitus. " 09/01/2016 - "Efficacy of lixisenatide in patients with type 2 diabetes: A post hoc analysis of patients with diverse β-cell function in the GetGoal-M and GetGoal-S trials." 01/01/2018 - "Safety, tolerability and efficacy of lixisenatide as monotherapy in Japanese patients with type 2 diabetes mellitus: An open-label, multicenter study." 01/01/2016 - "Evaluation of unmet medical need among Japanese patients with type 2 diabetes mellitus and efficacy of Lixisenatide treatment among Asian type 2 diabetes mellitus patients."
2.	Body Weight (Weight, Body) 12/01/2019 - "Compared with placebo, lixisenatide-treated patients had significantly greater reductions in HbA1c, 2-hour PPG, average seven-point SMPG, and body weight. " 02/01/2014 - "Lixisenatide one- or two-step dose-increase regimens significantly improved glycaemic control and decreased body weight over 24 weeks and during a long-term extension period without increasing hypoglycaemia. " 04/01/2018 - "Lixisenatide significantly reduced HbA1c (decrease by 9.7 ± 14.4 mmol/mol [3.1 ± 0.2 % DCCT] after 6 months in per protocol population), and body weight (decrease by 3.5 ± 5.4 kg). " 04/01/2017 - "A greater decrease in body weight was observed with lixisenatide (-1.47 kg) versus placebo (-0.16 kg; P < 0.0001). " 12/01/2016 - "The body weight of the lixisenatide group tended to decrease. "
3.	Hypoglycemia (Reactive Hypoglycemia) 04/01/2023 - "A higher proportion of participants in group 3 versus the other groups had symptomatic hypoglycemia, for both lixisenatide and placebo, and T2D duration had a significant effect on hypoglycemia risk (P = 0.001). " 12/01/2022 - "Compared with other subgroups taking BI and lixisenatide, the subgroup starting them simultaneously had a mean change in HbA1c of - 0.69% [8 mmol/mol] (vs + 0.07% [0.8 mmol/mol] to - 0.79% [9 mmol/mol]) and numerically higher treatment response (21.0% vs 8.3-18.7%), but more hypoglycemia (8.1% vs 2.3-2.8%). " 09/01/2021 - "Lixisenatide demonstrated a stronger association with hypoglycemia compared to other GLP-1RAs, according to the highest reporting odds ratio (ROR) (28.03, 95% confidence interval =15.92, 49.32), empirical Bayes geometric mean [26.00, 95% confidence interval (CI): 16.20], and proportional reporting ratio (PRR) (26.01, χ2=313.37). " 12/01/2019 - "Documented symptomatic hypoglycemia was approximately two-fold higher in patients treated with placebo than lixisenatide (12.7% vs 5.7%). " 12/01/2018 - "The risks for any adverse events, gastrointestinal adverse events, and symptomatic hypoglycemia significantly increased in the lixisenatide-treatedment group compared to those in the placebo group. "
4.	Weight Loss (Weight Reduction) 08/01/2017 - "Lixisenatide effectively lowers HbA1c levels in patients with T2D through a mechanism of action complementary to that of agents that mainly target FPG, with the additional benefit of weight loss. " 01/01/2022 - "Lixisenatide was well tolerated, with no unexpected ADRs or new safety signals identified, and showed effective glycemic control and weight reduction up to 3 years, supporting the use of lixisenatide as a safe and effective treatment option for T2D in routine clinical practice in Japan. " 01/01/2022 - "In this real-world post-marketing surveillance study, lixisenatide was well tolerated, raising no new safety concerns, and provided durable effective blood glucose control and weight reduction. " 06/01/2019 - "Lixisenatide as add-on therapy to OADs in a real-life setting led to significant improvements in glycaemic control with low incidence of hypoglycaemia and beneficial weight loss. " 03/01/2021 - "In addition, lixisenatide aggravated weight loss of tumour-bearing rats, suggesting that its use for treatment of T2DM patients with cancer should be avoided. "
5.	Diabetes Mellitus 08/01/2021 - "An individual-level pooled analysis of two multi-national phase III studies, GetGoal-L and GetGoal-L-C, was carried out to assess the efficacy of lixisenatide versus placebo as an add-on treatment to BI ± metformin in Asian and white patients with type 2 diabetes mellitus. " 06/01/2022 - "It is uncertain whether lixisenatide has postprandial insulinotropic effects when its effect on slowing gastric emptying is considered, in healthy subjects and type 2 diabetes mellitus (T2DM). " 08/01/2021 - "Adding lixisenatide to BI significantly reduced HbA1c and 2-h PPG levels in both Asian and white participants with type 2 diabetes mellitus. " 12/01/2023 - "The clinical benefits of treating patients with type 2 diabetes mellitus (T2DM) with fixed-ratio combination of insulin iGlar (iGlar) plus lixisenatide (iGlarLixi) were demonstrated in clinical trials and real-world evidence studies; however, its cost impact to healthcare payers is unknown. " 04/01/2023 - "iGlarLixi (insulin glargine 100 U/mL plus lixisenatide) has demonstrated glycaemic efficacy and safety in adults with inadequately controlled type 2 diabetes mellitus (T2DM). "

Related Drugs and Biologics

1.	Liraglutide
2.	Insulin (Novolin)
3.	Insulin Glargine (Lantus)
4.	Glucose (Dextrose)
5.	Glucagon-Like Peptide-1 Receptor
6.	Glucagon-Like Peptide 1 (GLP 1)
7.	Exenatide (Byetta)
8.	Metformin (Glucophage)
9.	Hypoglycemic Agents (Hypoglycemics)
10.	semaglutide

Related Therapies and Procedures

1.	Glycemic Control
2.	Therapeutics
3.	Injections
4.	Duration of Therapy
5.	Subcutaneous Injections