HOMEPRODUCTSSERVICESCOMPANYCONTACTFAQResearchDictionaryPharmaMobileSign Up FREE or Login

p66 - pituitary adenylate cyclase-activating peptide analog

a 31 amino acid pituitary adenylate cyclase-activating peptide analog formulated in several non-aqueous solvents in anticipation of improved shelf-life stability
Also Known As:
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY
Networked: 0 relevant articles (0 outcomes, 0 trials/studies)

Bio-Agent Context: Research Results