HOMEPRODUCTSSERVICESCOMPANYCONTACTFAQResearchDictionaryPharmaMobileSign Up FREE or Login

dual altered peptide ligand

artificial peptide with two immunodominant T-cell epitopes of the nicotinic acetylcholine receptor substituted with Lys-262 and Ala-207 (VIVKLIPSTSSAVDTPYLDITYHFVAQRLPL)
Also Known As:
dual APL
Networked: 9 relevant articles (0 outcomes, 0 trials/studies)

Bio-Agent Context: Research Results

Experts

1. Mozes, Edna: 7 articles (10/2007 - 06/2004)
2. Sela, Michael: 7 articles (10/2007 - 06/2004)
3. Ben-David, Hava: 4 articles (10/2007 - 02/2005)
4. Aruna, Badiga Venkata: 4 articles (11/2006 - 07/2005)
5. Dayan, Molly: 2 articles (10/2007 - 06/2004)
6. Mozes, E: 2 articles (06/2007 - 10/2001)
7. Sela, M: 2 articles (06/2007 - 10/2001)
8. Sharabi, Amir: 1 article (10/2007)
9. Ben-David, H: 1 article (06/2007)
10. Venkata Aruna, B: 1 article (06/2007)

Related Diseases

1. Myasthenia Gravis
2. Experimental Autoimmune Myasthenia Gravis (Autoimmune Experimental Myasthenia Gravis)

Related Drugs and Biologics

1. Peptides
2. Phosphotransferases (Kinase)
3. Fas Ligand Protein (Fas Ligand)
4. Caspase 8 (Caspase-8)
5. Transforming Growth Factor beta (TGF-beta)
6. Acetylcholine (Acetylcholine Chloride)
7. cytotoxic T-lymphocyte antigen 4

Related Therapies and Procedures

1. Immunomodulation