HOMEPRODUCTSSERVICESCOMPANYCONTACTFAQResearchDictionaryPharmaMobileSign Up FREE or Login

Bombina maxima bombinakinin M gene associated peptide

a bioactive 28-amino acid peptide from skin secretions of the toad Bombina maxima; amino acid sequence is DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH(2)
Also Known As:
bombinakinin M gene associated peptide, Bombina maxima; bombinakinin-GAP, B. maxima
Networked: 0 relevant articles (0 outcomes, 0 trials/studies)

Bio-Agent Context: Research Results