HOMEPRODUCTSSERVICESCOMPANYCONTACTFAQResearchDictionaryPharmaMobileSign Up FREE or Login

ZP10A peptide

a synthetic glucagon-like peptide 1 (GLP-1) receptor agonist; binds GLP-1 receptor; has antidiabetic effects in mice; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A)
Also Known As:
AQVE-10010; AVE 0010; AVE-0010; AVE0010; Lixisenatide; Zealand Pharma Brand of Lixisenatide
Networked: 56 relevant articles (13 outcomes, 15 trials/studies)

Relationship Network

Bio-Agent Context: Research Results

Experts

1. Miossec, Patrick: 7 articles (02/2015 - 06/2012)
2. Rosenstock, Julio: 6 articles (07/2015 - 09/2013)
3. Aronson, Ronnie: 6 articles (09/2014 - 09/2013)
4. Niemoeller, E: 5 articles (11/2015 - 10/2012)
5. Niemoeller, Elisabeth: 5 articles (11/2015 - 09/2013)
6. Raccah, Denis: 5 articles (02/2015 - 06/2012)
7. Ping, Lin: 4 articles (12/2015 - 09/2013)
8. Riddle, Matthew C: 4 articles (12/2015 - 09/2013)
9. Knop, Filip K: 4 articles (10/2014 - 08/2009)
10. Christensen, Mikkel: 4 articles (10/2014 - 08/2009)

Related Diseases

1. Body Weight (Weight, Body)
2. Weight Loss (Weight Reduction)
3. Type 2 Diabetes Mellitus (MODY)
4. Hypoglycemia (Reactive Hypoglycemia)
5. Amyloid Plaque

Related Drugs and Biologics

1. Glucagon-Like Peptide 1 (GLP 1)
2. liraglutide
3. Glucose (Dextrose)
4. exenatide (Byetta)
5. basal insulin
6. Insulin (Novolin)
7. NPH Insulin
8. glargine (insulin glargine)
9. ZP10A peptide
10. Metformin (Glucophage)

Related Therapies and Procedures

1. Injections
2. Subcutaneous Injections