HOMEPRODUCTSSERVICESCOMPANYCONTACTFAQResearchDictionaryPharmaMobileSign Up FREE or Login

Conus radiatus conophysin-R

the distinctive disulfide framework and sequence indicates that it is a member of the neurophysin peptide family; MW 8810.89 Da; sequence of the peptide is HPTKPCMYCSFGQCVGPHICCGPTGCEMGTAEANMCSEEDEDPIPCQVFGSDCALNNPDNIHGHCVADGICCVDDTCTTHLGCL, in first source
Also Known As:
conophysin-R, Conus radiatus; conophysin-R, C radiatus
Networked: 0 relevant articles (0 outcomes, 0 trials/studies)

Bio-Agent Context: Research Results