DARP-36aa

a synthetic neurotrophic peptide corresponding to the N terminal of dopamine-releasing protein that selectively promotes the survival and development of mesencephalic neurons

Also Known As:

DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS

Networked: 2 relevant articles (0 outcomes, 1 trials/studies)

Bio-Agent Context: Research Results

Amino Acids, Peptides, and Proteins: 1
- Proteins: 484843
  - Nerve Tissue Proteins: 2
    - DARP-36aa: 2
- Peptides: 82426
  - Peptide Fragments: 373
    - DARP-36aa: 2

Experts

1.	Ramirez, Victor D: 2 articles (01/2003 - 02/2002)
2.	Smith, Sean M: 1 article (01/2003)
3.	Smith, Sean: 1 article (02/2002)

Related Diseases

Glioma (Gliomas)

01/01/2003 - "Similar to cultures treated with DARP-36aa, immunoneutralization of DARP had no effect on any parameters examined in primary diencephalic and C6 glioma cultures. "
01/01/2003 - "DARP-36aa selectively affected mesencephalic cultures; diencephalic and C6 glioma cells were not affected by DARP-36aa treatments. "
02/01/2002 - "In the present study, we examined the internalization and transport of DARP-36aa, a synthetic peptide derived from the N-terminal sequence of DARP, in rat C6 glioma cells. "

Related Drugs and Biologics

1.	Peptides (Polypeptides)