HOMEPRODUCTSSERVICESCOMPANYCONTACTFAQResearchDictionaryPharmaMobileSign Up FREE or Login

DARP-36aa

a synthetic neurotrophic peptide corresponding to the N terminal of dopamine-releasing protein that selectively promotes the survival and development of mesencephalic neurons
Also Known As:
DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS
Networked: 2 relevant articles (0 outcomes, 1 trials/studies)

Bio-Agent Context: Research Results

Experts

1. Ramirez, Victor D: 2 articles (01/2003 - 02/2002)
2. Smith, Sean M: 1 article (01/2003)
3. Smith, Sean: 1 article (02/2002)

Related Diseases

1. Glioma (Gliomas)